PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009625506.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family STAT
Protein Properties Length: 695aa    MW: 78475.8 Da    PI: 5.5391
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009625506.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT189.63.5e-592093281120
            STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkky 95 
                     ldv+l++++++p++ +vevva L+yad+ ++vek+ d+eapLL++ydG+e++s+drp+k++ GrasfklkisqLsskcdnrLf+i+feipk+ +y
  XP_009625506.1 209 LDVTLMDSFSRPITEEVEVVALLVYADDEAPVEKPVDDEAPLLTNYDGIEYASSDRPSKVISGRASFKLKISQLSSKCDNRLFCIRFEIPKMGNY 303
                     89********************************************************************************************* PP

            STAT  96 pfleavskpirCisrsrntrssslt 120
                     pfle++s+pirCisr+rntr++sl+
  XP_009625506.1 304 PFLEVFSRPIRCISRNRNTRAASLM 328
                     ********************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF498996.55E-821131IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:2.60.120.2006.3E-564136IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:3.30.505.102.5E-7598655IPR000980SH2 domain
SuperFamilySSF555504.27E-10599659IPR000980SH2 domain
PROSITE profilePS5000110.39601679IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 695 aa     Download sequence    Send to blast
MGIQDYGFLE DLQVEFKDYD GTNGFFLCFW FYLNKASTLP STILLQIMQK HPVATSHAPF  60
LLLDEKKRLL LYPLLTSWRE DAYATSESEF PMKKWVHVGC EVTKDLLRLY LDGEIVGEKS  120
LTSSLNNDSV SDSSEISLPC ISGKGSQLDG YVYSAELLPV VSSIKNHYVK DPPVQLSIDS  180
SSAYEIEEDT DGVWSIVGGK ASCRRNFSLD VTLMDSFSRP ITEEVEVVAL LVYADDEAPV  240
EKPVDDEAPL LTNYDGIEYA SSDRPSKVIS GRASFKLKIS QLSSKCDNRL FCIRFEIPKM  300
GNYPFLEVFS RPIRCISRNR NTRAASLMLR KSSLGIHLLN GSQSPILEDG SSDLPSIVRE  360
AKQSLSSKRV KLGQEKLCAN FKDDFVLQQA NGESKSHSWI SEDNYAYHNS LVARPVSRGR  420
AENFSSDSEN SETTNSVIDD LPSNRDPISD VDVFKYCLGD LNERRLLLKE MAVTAKEEEL  480
ATFAERVSLF SGCSHHRHQI SISKRLIEEG IKCWNLISDD NHHVPWMNLV SGLQEHFLKM  540
TFGRTRSLTH QDFDLLRRVS SCQDLVSQDN FEKLWCWLYP VAFTLSQQCI TSLWGSASPV  600
WIEGFITKEE AESSLRGQGP GTFILRFPTS RSWPHPDAGN LVATYVGSDY TIHHRLVSLD  660
FIYSFGSKGM TIKPIQDMLL EQPELRRLGR IVRSQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2103541e-127AC210354.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 7 clone C07HBa0102J11, complete sequence.
GenBankHG9755191e-127HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009625506.10.0PREDICTED: uncharacterized protein LOC104116371 isoform X1
TrEMBLA0A0V0INF70.0A0A0V0INF7_SOLCH; Putative ovule protein
STRINGSolyc07g062050.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA93942325
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B